PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.5W0HK
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB_related
Protein Properties Length: 145aa    MW: 17071.9 Da    PI: 10.908
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.5W0HKgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.14e-1384121847
                      HHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   8 EdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      E++  +d+++ql ++ W+ I ++++ gRt++++k++w+++
      Aradu.5W0HK  84 EEKMVIDLHAQLRNR-WSMITSHLP-GRTDNEIKNHWNTH 121
                      8999***********.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.6E-63460IPR009057Homeodomain-like
SuperFamilySSF466894.62E-1337118IPR009057Homeodomain-like
SMARTSM007177.0E-1039124IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-1870127IPR009057Homeodomain-like
PROSITE profilePS5129419.70772126IPR017930Myb domain
PfamPF002493.8E-1084121IPR001005SANT/Myb domain
CDDcd001671.50E-884122No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 145 aa     Download sequence    Send to blast
RKQSVERNRE DKDSKFRLIS LITSLRFRFS PTTLSVGLKK GPWTAEEDKK LINFILNNGQ  60
CVVKVALVDN LRPYVKRGLL LKYEEKMVID LHAQLRNRWS MITSHLPGRT DNEIKNHWNT  120
HIKKKLKKLR IDPVTYKPFS NNTTD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-16381265108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001234300.21e-52myb-related transcription factor
RefseqXP_006364618.12e-52PREDICTED: protein ODORANT1
RefseqXP_015057255.12e-52PREDICTED: protein ODORANT1
SwissprotQ50EX62e-44ODO1_PETHY; Protein ODORANT1
TrEMBLQ401737e-53Q40173_SOLLC; Myb-related transcription factor
TrEMBLK4D5R22e-52K4D5R2_SOLLC; Uncharacterized protein
TrEMBLM1B9Y82e-52M1B9Y8_SOLTU; Uncharacterized protein
TrEMBLA0A0B2QDS73e-52A0A0B2QDS7_GLYSO; Protein ODORANT1
TrEMBLI1LMB73e-52I1LMB7_SOYBN; Uncharacterized protein
STRINGSolyc11g011050.1.14e-52(Solanum lycopersicum)
STRINGPGSC0003DMT4000404625e-52(Solanum tuberosum)
STRINGGLYMA11G33620.19e-52(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66230.13e-52myb domain protein 20